Bacterial taxon 1392858
Locus CO715_18845
Protein ATI07592.1
flavin reductase family protein
Escherichia coli M12
Length 189 aa, Gene n/a, UniProt n/a
>ATI07592.1|Escherichia coli M12|flavin reductase family protein
MSRFIPVELHHASRLLNHGPTILITTFDEKSQRRNVMAAAWSMPVEFEPPRVAIVVDKSTWTRELIERNGKFGIVIPGVAATNWTWAVGSVSGREEDKFNCYGIPVVKGPVLGLPLVEEKCLAWMECRLLPATSAQEKYDTLFGEVVSAAADARVFVEGRWQFDDDKLNKLHHLGAGTFVTSGKRVTAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.46 | 2.0e-25 | ●○○○○ -0.59 | -0.5930901072807963 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.15 | 1.1e-5 | ○○○○○ 1 | 0.9955406452100334 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)