Bacterial taxon 1392858
Locus CO715_17000
Protein ATI07263.1
formate hydrogenlyase regulatory protein HycA
Escherichia coli M12
Length 153 aa, Gene n/a, UniProt n/a
>ATI07263.1|Escherichia coli M12|formate hydrogenlyase regulatory protein HycA
MTIWEISEKADYIAQRHRRLQDQWHIYCNSLVQGITLSKARLHHAMSCAPDKELCFVLFEHFRIYVTLADGFNSHTIEYYVETKDGEDKQRIAQAQLSIDGMIDGKVNIRDREQVLEHYLEKIAGVYDSLYTAIENNVPVNLSQLVKGQSPAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.13 | 0.0083 | ○○○○○ 0.1 | 0.10190976618216063 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.04 | 0.017 | ○○○○○ 0.97 | 0.9715463535714143 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)