Bacterial taxon 1392858
Locus CO715_06400
Protein ATI05382.1
formyltetrahydrofolate deformylase
Escherichia coli M12
Length 280 aa, Gene n/a, UniProt n/a
>ATI05382.1|Escherichia coli M12|formyltetrahydrofolate deformylase
MHSLQRKVLRTICPDQKGLIARITNICYKHELNIVQNNEFVDHRTGRFFMRTELEGIFNDSTLLADLDSALPEGSVRELNPAGRRRIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHDTLRSLVERFDIPFELVSHEGLSRNEHDQKMADAIDAYQPDYVVLAKYMRVLTPEFVARFPNKIINIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAEDMMRAGRDVEKNVLSRALYKVLAQRVFVYGNRTIIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9 | 2.9e-171 | ●●○○○ -1.33 | -1.3319056437360137 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.95 | 0.00016 | ○○○○○ 0.74 | 0.7432876139831601 | 29101196 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)