Bacterial taxon 1392858
Locus CO715_20195
Protein ATI07838.1
fructokinase
Escherichia coli M12
Length 302 aa, Gene n/a, UniProt n/a
>ATI07838.1|Escherichia coli M12|fructokinase
MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGKQGCIETFISGTGFATDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVPQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWLWPQE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.44 | 0.022 | ●○○○○ -0.38 | -0.3794365886899623 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.97 | 3.2e-8 | ●○○○○ -0.07 | -0.07356153180113173 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)