Bacterial taxon 1392858
Locus CO715_16820
Protein ATI07235.1
fructose-1-phosphate/6-phosphogluconate phosphatase
Escherichia coli M12
Length 188 aa, Gene n/a, UniProt n/a
>ATI07235.1|Escherichia coli M12|fructose-1-phosphate/6-phosphogluconate phosphatase
MYERYAGLIFDMDGTILDTEPTHRKAWREVLGHYGLQYDVQAMIALNGSPTWRIAQAIIELNQADLDPHALAREKTEAVRSMLLDSVEPLPLVEVVKSWHGRRPMAVGTGSESAIAEALLAHLGLRHYFDAVVAADHVKHHKPAPDTFLLCAQRMGVQPTQCVVFEDADFGIQAARAAGMDAVDVRLL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.46 | 0.0033 | ●●○○○ -1.01 | -1.0101734897642698 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.26 | 3.4e-20 | ●○○○○ -0.97 | -0.9680269948859999 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)