Bacterial taxon 1392858
Locus CO715_01450
Protein ATI04512.1
fumarate reductase iron-sulfur subunit
Escherichia coli M12
Length 244 aa, Gene n/a, UniProt n/a
>ATI04512.1|Escherichia coli M12|fumarate reductase iron-sulfur subunit
MAEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.24 | 7.0e-24 | ●●○○○ -1.8 | -1.7986467776107165 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.09 | 7.7e-6 | ○○○○○ 0.98 | 0.9830218843551016 | 29101196 |
Retrieved 2 of 2 entries in 13.9 ms
(Link to these results)