Bacterial taxon 1392858
Locus CO715_01460
Protein ATI04514.1
fumarate reductase subunit D
Escherichia coli M12
Length 119 aa, Gene n/a, UniProt n/a
>ATI04514.1|Escherichia coli M12|fumarate reductase subunit D
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.94 | 0.0018 | ●○○○○ -0.27 | -0.2749049355512828 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4.14 | 0.0014 | ○○○○○ 1.41 | 1.4094943374797742 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)