Bacterial taxon 1392858
Locus CO715_21835
Protein ATI08137.1
galactitol-1-phosphate 5-dehydrogenase
Escherichia coli M12
Length 346 aa, Gene n/a, UniProt n/a
>ATI08137.1|Escherichia coli M12|galactitol-1-phosphate 5-dehydrogenase
MKSVVNDTDGIVRIAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMSIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSLEMSAPQMQGVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.92 | 2.2e-22 | ○○○○○ 0.15 | 0.1457254291744215 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.17 | 1.4e-9 | ○○○○○ 0.3 | 0.30241858587531634 | 29101196 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)