Bacterial taxon 1392858
Locus CO715_02800
Protein ATI04760.1
GDP-mannose pyrophosphatase NudK
Escherichia coli M12
Length 191 aa, Gene n/a, UniProt n/a
>ATI04760.1|Escherichia coli M12|GDP-mannose pyrophosphatase NudK
MTQQITLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKREVYDRGNGATILLYNAKKKTVVLIRQFRVATWVNGNESGQLIETCAGLLDNDEPEVCIRKEAIEETGYEVGEVRKLFELYMSPGGVTELIHFFIAEYSDNQRANAGGGVEDEDIEVLELPFSQALEMIKTGEIRDGKTVLLLNYLQTSHLMD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.33 | 0.0016 | ●○○○○ -0.36 | -0.3577374032080807 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.25 | 2.0e-8 | ○○○○○ 0.81 | 0.806716002314814 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)