Bacterial taxon 1392858
Locus CO715_12175
Protein ATI06399.1
general secretion pathway protein
Escherichia coli M12
Length 178 aa, Gene n/a, UniProt n/a
>ATI06399.1|Escherichia coli M12|general secretion pathway protein
MLRDKFIHYFQQWRERQLSRGEHWLTQHLAGRSPREKGMLLAAVVFLFSAGYYVLIWQPLSERIEQQETMLQQLVAMNARLKSAAPDIIAARKSGTTTPAQVSRVISDSASAHSVVIKRIAERGENIQVWIEPVVFNDLLNWLKALDEKYALRVTQIDVSAGEKPGMVNVQRLEFGRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.71 | 1.4e-11 | ●○○○○ -0.64 | -0.644625672800265 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.79 | 0.019 | ○○○○○ 0.92 | 0.9191762039949503 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)