Bacterial taxon 1392858
Locus CO715_06650
Protein ATI05422.1
GlsB/YeaQ/YmgE family stress response membrane protein
Escherichia coli M12
Length 84 aa, Gene n/a, UniProt n/a
>ATI05422.1|Escherichia coli M12|GlsB/YeaQ/YmgE family stress response membrane protein
MGIIAWIIFGLIAGIIAKLIMPGRDGGGFFLTCILGIVGAVVGGWLATMFGIGGSISGFNLHSFLVAVVGAILVLGVFRLLRRE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.7 | 5.7e-15 | ●●○○○ -1.27 | -1.2699377775041023 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.87 | 1.0e-13 | ●●○○○ -1.1 | -1.0959270016205518 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)