Bacterial taxon 1392858
Locus CO715_15255
Protein ATI06951.1
glucose-1-phosphatase
Escherichia coli M12
Length 199 aa, Gene n/a, UniProt n/a
>ATI06951.1|Escherichia coli M12|glucose-1-phosphatase
MLYIFDLGNVIVDIDFNRVLGAWSDLTRVPLATLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPGYFAKVLC
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.85 | 8.8e-8 | ●○○○○ -0.05 | -0.047689426034272904 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.89 | 5.8e-8 | ○○○○○ 1.15 | 1.1484781736544487 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)