Bacterial taxon 1392858
Locus CO715_08770
Protein ATI05798.1
glutamine ABC transporter ATP-binding protein
Escherichia coli M12
Length 240 aa, Gene n/a, UniProt n/a
>ATI05798.1|Escherichia coli M12|glutamine ABC transporter ATP-binding protein
MIEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANKEEAEKLARELLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGDPQVLIKNPPSQRLQEFLQHVS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.87 | 6.3e-24 | ●○○○○ -0.89 | -0.8881155714286859 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.45 | 6.5e-22 | ○○○○○ 1.47 | 1.4745918939254188 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)