Bacterial taxon 1392858
Locus CO715_12770
Protein ATI06503.1
glutamine amidotransferase
Escherichia coli M12
Length 172 aa, Gene n/a, UniProt n/a
>ATI06503.1|Escherichia coli M12|glutamine amidotransferase
MSKKIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTPDDLPAFNREALRLLGA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 21.66 | 1.5e-8 | ○○○○○ 5.06 | 5.064555215091326 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 22.88 | 6.9e-10 | ○○○○○ 5.32 | 5.320772520588927 | 29101196 |
Retrieved 2 of 2 entries in 20.4 ms
(Link to these results)