Bacterial taxon 1392858
Locus CO715_13070
Protein ATI06557.1
glutamine amidotransferase
Escherichia coli M12
Length 217 aa, Gene n/a, UniProt n/a
>ATI06557.1|Escherichia coli M12|glutamine amidotransferase
MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMTETRNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMCIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVVDEDNKIVTTPAYMLAQNIAEAASGIDKLVSRVLVLAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.94 | 0.025 | ●○○○○ -0.48 | -0.48375959581439293 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.84 | 0.00017 | ○○○○○ 1.76 | 1.7635666236600918 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)