Bacterial taxon 1392858
Locus CO715_20810
Protein ATI07949.1
glutaredoxin 2
Escherichia coli M12
Length 215 aa, Gene n/a, UniProt n/a
>ATI07949.1|Escherichia coli M12|glutaredoxin 2
MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.49 | 0.00012 | ○○○○○ 0.24 | 0.2354432153014318 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.9 | 0.014 | ○○○○○ 0.36 | 0.35770977965126455 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)