Bacterial taxon 1392858
Locus CO715_08625
Protein ATI05772.1
glutathione ABC transporter permease GsiD
Escherichia coli M12
Length 303 aa, Gene n/a, UniProt n/a
>ATI05772.1|Escherichia coli M12|glutathione ABC transporter permease GsiD
MRLFNWRRQAVLNAMPLVKPDQVRTPWHEFWRRFRRQHMAMTAALFVILLIVVAIFARWIAPYDAENYFDYDNLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAAIGTLLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAVAIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTILLRHILPGTVSSIVVFFTMRIGTSIISAASLSFLGLGAQPPTPEWGAMLNEARADMVIAPHVAIFPALAIFLTVLAFNLLGDGLRDALDPKIKG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.33 | 6.9e-9 | ●●○○○ -1.61 | -1.608570258630004 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.06 | 8.0e-9 | ●●○○○ -1.34 | -1.3431725285054523 | 29101196 |
Retrieved 2 of 2 entries in 11.2 ms
(Link to these results)