Bacterial taxon 1392858
Locus CO715_04155
Protein ATI05007.1
glutathione-regulated potassium-efflux system ancillary protein KefG
Escherichia coli M12
Length 184 aa, Gene n/a, UniProt n/a
>ATI05007.1|Escherichia coli M12|glutathione-regulated potassium-efflux system ancillary protein KefG
MMSQPAKVLLLYAHPESQDSVANRVLLKPATQLSNVTVHDLYAHYPDFFIDIPREQALLREHEVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLAGKYWRSVITTGEPESAYRYDALNRYPMSDVLRPFELAAGMCRMHWLSPIIIYWARRQSAQELASHARAYGDWLANPLSPGGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.09 | 8.4e-26 | ●●○○○ -1.56 | -1.5595384452815217 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.9 | 1.5e-5 | ○○○○○ 0.15 | 0.15073293351639416 | 29101196 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)