Bacterial taxon 1392858
Locus CO715_02730
Protein ATI04747.1
glycine cleavage system transcriptional repressor
Escherichia coli M12
Length 190 aa, Gene n/a, UniProt n/a
>ATI04747.1|Escherichia coli M12|glycine cleavage system transcriptional repressor
MTLSSQHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGEEFTFIMLLSGSWNAITLIESTLPLKGAELDLLIVMKRTTARPRPPMPASVWVQVDVADSPHLIERFTALFDAHHMNIAELVSRTQPAENERAAQLHIQITAHSPASADAANIEQAFKALCTELNAQGSINVVNYSQHDEQDGVK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.95 | 0.011 | ●○○○○ -0.9 | -0.9037640224973505 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.89 | 0.02 | ●○○○○ -0.68 | -0.6823906013793088 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)