Bacterial taxon 1392858
Locus CO715_11695
Protein ATI06309.1
glycogen synthase
Escherichia coli M12
Length 66 aa, Gene n/a, UniProt n/a
>ATI06309.1|Escherichia coli M12|glycogen synthase
MDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQTRELELEH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.03 | 0.00014 | ●○○○○ -0.92 | -0.9206643496515085 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.31 | 0.047 | ○○○○○ 0.06 | 0.06435348361736558 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)