Bacterial taxon 1392858
Locus CO715_08530
Protein ATI05755.1
GrxA family glutaredoxin
Escherichia coli M12
Length 85 aa, Gene n/a, UniProt n/a
>ATI05755.1|Escherichia coli M12|GrxA family glutaredoxin
MQTVIFGRPGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.87 | 0.0014 | ●○○○○ -0.89 | -0.886446403314695 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.93 | 0.027 | ●○○○○ -0.48 | -0.48229907371465097 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)