Bacterial taxon 1392858
Locus CO715_24775
Protein ATI08638.1
GTPase-activating protein
Escherichia coli M12
Length 169 aa, Gene n/a, UniProt n/a
>ATI08638.1|Escherichia coli M12|GTPase-activating protein
MKPSSSNSRSKGHAKARRKTREELDQEARDRKRQKKRRGHAPGSRAAGGNTTSGSKGQNAPKDPRIGSKTPIPLGVTEKVTKQHKPKSEKPMLSPQAELELLETDERLDALLERLEAGETLSAEEQSWVDAKLDRIDELMQKLGLSYDDDEEEEEDEKQEDMMRLLRGN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.12 | 0.0051 | ●○○○○ -0.31 | -0.31246121811607785 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.57 | 0.00075 | ○○○○○ 1.5 | 1.5004639996922775 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)