Bacterial taxon 1392858
Locus CO715_05780
Protein ATI05277.1
head decoration protein
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI05277.1|Escherichia coli M12|head decoration protein
MTSKETFTHYQPLGNSDPAHTATAPGGLSAKAPAMTPLMLDTSTRKLVVWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -13.13 | 5.7e-14 | ●●●○○ -2.19 | -2.19382232859806 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.31 | 6.9e-11 | ●●○○○ -1.81 | -1.8136692906366347 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)