Bacterial taxon 1392858
Locus CO715_21755
Protein ATI08122.1
heavy metal resistance protein
Escherichia coli M12
Length 112 aa, Gene n/a, UniProt n/a
>ATI08122.1|Escherichia coli M12|heavy metal resistance protein
MTIKNKMLLGVLLLVTSAAWAAPATAGSTNTSGISKYELSSFIADFKHFKPGDTVPEMYRTDEYNIKQWQLRNLPAPDAGTHWTYMGGAYVLINDTDGKIIKAYDGEIFYHR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.01 | 3.8e-9 | ○○○○○ 0.13 | 0.12778187194901944 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.67 | 0.043 | ○○○○○ 0.41 | 0.4069502390139958 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)