Bacterial taxon 1392858
Locus CO715_07845
Protein ATI05631.1
helix-turn-helix domain-containing protein
Escherichia coli M12
Length 313 aa, Gene n/a, UniProt n/a
>ATI05631.1|Escherichia coli M12|helix-turn-helix domain-containing protein
MSTKLTGYVWDGCAASGMKLSSVAIMARLADFSNDEGVCWPSIETIARQIGAGMSTVRTAIARLEAEGWLTRRARRQGNRNASNVYQLNVAKLQAAAFSQLSDSDPSKSDASKSDPSKFDASKSGKKAGFHPSESGGDPSVKSKHDPSDKKTSRPDASQPDTQTAEQDFLTRHPDAVVFSPKKRQWGTQDDLTCAQWLWKKIIALYEHAAECDGEVVRPKEPNWIAWANEIRLMCVQDGRTHKQICEMYSRVSRDPFWCRNVLSPSKLREKWDELSLRLSPSVSTYTEKREDPYFKASYDNVDYSQIPAGFRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -13.1 | 3.7e-8 | ●●●○○ -2.19 | -2.187562948170594 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.62 | 3.0e-5 | ●●○○○ -1.25 | -1.2530374503499442 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)