Bacterial taxon 1392858
Locus CO715_14295
Protein ATI06773.1
hemin import ATP-binding protein HmuV
Escherichia coli M12
Length 256 aa, Gene n/a, UniProt n/a
>ATI06773.1|Escherichia coli M12|hemin import ATP-binding protein HmuV
MISAQNLVYSLQGRRLTDNVSLTFPGGEIVAILGPNGAGKSTLLRQLTGYLQPDSGECRLFNKPLNEWSITELAKHRAVMRQNSHMAFPFSVQEVIQMGRHPHRTGNQDNETAQIMALCDCQALANRDYRQLSGGEQQRVQLARLLVQLWEPTPSPKWLFLDEPTSALDIHHQQHLFRLLRQLVHERQFNVCCVLHDLNLAARYADRIVLMQKGKVIANGKPQDVLTQQALTMLYGADITVLKDPANHSPLIVLDH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.51 | 2.1e-12 | ○○○○○ 0.23 | 0.23064435697370803 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.71 | 7.7e-15 | ○○○○○ 0.9 | 0.9026931688692901 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)