Bacterial taxon 1392858
Locus CO715_19850
Protein ATI07773.1
hemolysin expression-modulating protein Hha
Escherichia coli M12
Length 72 aa, Gene n/a, UniProt n/a
>ATI07773.1|Escherichia coli M12|hemolysin expression-modulating protein Hha
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.31 | 0.0018 | ●●○○○ -1.6 | -1.6043973383450267 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.89 | 0.0046 | ●●○○○ -1.52 | -1.5167660123605051 | 29101196 |
Retrieved 2 of 2 entries in 2.2 ms
(Link to these results)