Bacterial taxon 1392858
Locus CO715_13510
Protein ATI06633.1
HNH endonuclease
Escherichia coli M12
Length 169 aa, Gene n/a, UniProt n/a
>ATI06633.1|Escherichia coli M12|HNH endonuclease
MVNDAYAPELLRSLFLYDPVTGRLHHKANRRRVKAGSYADSTRRADGYRQVALRLDGKQYQLKAHRVAWILAHGAIPDGLQVDHINGIRDDNRLCNLRLVTQRENDQNRRKARGYSWNKGCSKWEAYIRVDGVLRYLGLFTTEAAARAAYLKAKARYHPTTPADLLRAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.39 | 1.3e-6 | ○○○○○ 0.84 | 0.8367610283666499 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.45 | 8.7e-17 | ○○○○○ 1.06 | 1.0568825733991987 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)