Bacterial taxon 1392858
Locus CO715_00565
Protein ATI04359.1
Hok/Gef family protein
Escherichia coli M12
Length 70 aa, Gene n/a, UniProt n/a
>ATI04359.1|Escherichia coli M12|Hok/Gef family protein
MHRHHKVSLLLVGNQHRGLGMPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.69 | 1.6e-14 | ●●○○○ -1.27 | -1.2663907952618714 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.91 | 9.0e-9 | ○○○○○ 1.15 | 1.1524424479251771 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)