Bacterial taxon 1392858
Locus CO715_06970
Protein ATI05478.1
holin
Escherichia coli M12
Length 71 aa, Gene n/a, UniProt n/a
>ATI05478.1|Escherichia coli M12|holin
MKSMDKLTTGIAYGTSAGSAGYWFLQWLDQVSPSQWAAIGVLGSLVLGFLTYLTNLYFKIKEDKRKAARGE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.24 | 2.5e-40 | ●●○○○ -1.17 | -1.1735433189211284 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.68 | 3.9e-24 | ●○○○○ -0.43 | -0.429511632109689 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)