Bacterial taxon 1392858
Locus CO715_02700
Protein ATI04741.1
hydrogenase 4 membrane subunit
Escherichia coli M12
Length 216 aa, Gene n/a, UniProt n/a
>ATI04741.1|Escherichia coli M12|hydrogenase 4 membrane subunit
MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIWSASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMTLLAALIVLLCAFVVQPVKLPMATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIGIATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.01 | 5.9e-14 | ●●○○○ -1.75 | -1.7517014244047227 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.95 | 4.5e-14 | ○○○○○ 1.16 | 1.1607882884951315 | 29101196 |
Retrieved 2 of 2 entries in 25.4 ms
(Link to these results)