Bacterial taxon 1392858
Locus CO715_02685
Protein ATI04738.1
hydrogenase 4 subunit H
Escherichia coli M12
Length 181 aa, Gene n/a, UniProt n/a
>ATI04738.1|Escherichia coli M12|hydrogenase 4 subunit H
MLKLLKTIMRAGTATVKYPFAPLEVSPGFRGKPDLMPSQCIACGACACACPANALTIQTDDQQNTRTWQLYLGRCIYCGRCEEVCPTRAIQLTNNFELTVTNKADLYTRATFHLQRCSRCERPFAPQKTVALAAELLAQQQNAPQNREMLRAQASVCPECKQRATLINDDTDEPLVAKEQL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.65 | 5.7e-6 | ●●○○○ -1.05 | -1.0498162324715534 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.83 | 5.4e-15 | ○○○○○ 1.76 | 1.761480163517603 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)