Bacterial taxon 1392858
Locus CO715_14610
Protein ATI06834.1
hydroxymyristoyl-ACP dehydratase
Escherichia coli M12
Length 117 aa, Gene n/a, UniProt n/a
>ATI06834.1|Escherichia coli M12|hydroxymyristoyl-ACP dehydratase
MKPHEIERHQAQANHLEIVLHLRADLFWFRGHFAVQPLLPGVAQIDWAMSYALTLLAPGWRFHSIQNIKFQSPLLPDNRVTLTLNWQEERQILSFSYQRHDGDARHTASSGKIRLCR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.26 | 0.044 | ○○○○○ 0.07 | 0.07457713831555986 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.9 | 1.6e-13 | ○○○○○ 0.36 | 0.35917030175100656 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)