Bacterial taxon 1392858
Locus CO715_00370
Protein ATI04324.1
hypothetical protein
Escherichia coli M12
Length 140 aa, Gene n/a, UniProt n/a
>ATI04324.1|Escherichia coli M12|hypothetical protein
MNSLRYFDFGAARPVLLLIARIAVVLIFIIFGFPKMMGFDGTVQYMASLGAPMPMLAAIIAVVMEVPAAILIVLGFFTRPLAVLFIFYTLGTAVIGHHYWDMTGDAVGPNMINFWKNVSIAGAFLLLAITGPGAISLDRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.02 | 2.1e-13 | ●○○○○ -0.29 | -0.29284849277668484 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.83 | 0.00018 | ○○○○○ 0.17 | 0.16533815451381445 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)