Bacterial taxon 1392858
Locus CO715_01810
Protein ATI04577.1
hypothetical protein
Escherichia coli M12
Length 91 aa, Gene n/a, UniProt n/a
>ATI04577.1|Escherichia coli M12|hypothetical protein
MPTVLSRMAMQLKKTAWIIPVFMVSGCSLSPAIPVIGAYYPSWFFCAIASLILTLITRRIIQRANINLAFVGIIYTALFALYAMLLWLAFF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.66 | 0.03 | ○○○○○ 0.68 | 0.6842407919507324 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.62 | 2.7e-7 | ○○○○○ 0.88 | 0.8847496116438881 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)