Bacterial taxon 1392858
Locus CO715_01835
Protein ATI04582.1
hypothetical protein
Escherichia coli M12
Length 229 aa, Gene n/a, UniProt n/a
>ATI04582.1|Escherichia coli M12|hypothetical protein
MKKIIALMLFLTFFAHANDSEPGSQYLKAAEAGDRRAQYFLADSWFSSGDLSKAEYWAQKAADSGDADACALLAQIKITNPVSLDYPQAKVLAEKAAQAGSKEGEVTLAHILVNTQAGKPDYPKAISLLENASEDLENDSAVDAQMLLGLIYANGVGIKADDDKATWYFKRSSAISRTGYSEYWAGMMFLNGEEGFIEKNKQKALHWLNLSCMEGFDTGCEEFEKLTNG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1 | 0.0054 | ○○○○○ 0.76 | 0.7555977288238429 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.41 | 0.00019 | ○○○○○ 0.84 | 0.8394734265518851 | 29101196 |
Retrieved 2 of 2 entries in 15.6 ms
(Link to these results)