Bacterial taxon 1392858
Locus CO715_01900
Protein ATI04592.1
hypothetical protein
Escherichia coli M12
Length 104 aa, Gene n/a, UniProt n/a
>ATI04592.1|Escherichia coli M12|hypothetical protein
MNGTIYQRIEDNAHFRELVEKRQRFATILSIIMLAVYIGFILLIAFAPGWLGTPLNPNTSVTRGIPIGVGVIVISFVLTGIYIWRANGEFDRLNNEVLHEVQAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.92 | 6.4e-15 | ●○○○○ -0.48 | -0.4812558436434067 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.1 | 0.00043 | ○○○○○ 0.98 | 0.9842737604405948 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)