Bacterial taxon 1392858
Locus CO715_01955
Protein ATI04603.1
hypothetical protein
Escherichia coli M12
Length 93 aa, Gene n/a, UniProt n/a
>ATI04603.1|Escherichia coli M12|hypothetical protein
MATLTTGVVLLRWQLLSAVMMFLASTLNIRFRRSDYVGLAVISSGLGVVSACWFAMGLLGITMADITAIWHNIESVMIEEMNQTPPQWPMILT
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.63 | 0.016 | ●○○○○ -0.84 | -0.8365800059092172 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.68 | 0.049 | ●○○○○ -0.43 | -0.42972027812393776 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)