Bacterial taxon 1392858
Locus CO715_02130
Protein ATI04635.1
hypothetical protein
Escherichia coli M12
Length 212 aa, Gene n/a, UniProt n/a
>ATI04635.1|Escherichia coli M12|hypothetical protein
MKRPALILICLLLQACSATTKELGNSLWDSLFGTPGVQLTDDDIQNMPYASQYMQLNGGPQLFVVLAFAEDGQQKWVTQDQATLVTQHGRLVKTLLGGDNLIDVNNLAADPLIKPAQIVDGATWTRTMGWTEYQQVRYATARSVFKWDGTDTVKVGSDETPVRVLDEDVSTDQARWHNRYWIDSEGQIRQSEQYLGADYFPVKTTLIKAAKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.03 | 0.0067 | ○○○○○ 0.33 | 0.3303771517846637 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.7 | 4.8e-12 | ○○○○○ 1.11 | 1.109044076961414 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)