Bacterial taxon 1392858
Locus CO715_02135
Protein ATI04636.1
hypothetical protein
Escherichia coli M12
Length 80 aa, Gene n/a, UniProt n/a
>ATI04636.1|Escherichia coli M12|hypothetical protein
MKKVLYGIFAISALAATSAWAAPVQVGEAAGSAATSVSAGSSSATSVSTVSSAVGVALAATGGGDGSNTGTTTTTTTSTQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.15 | 0.00011 | ○○○○○ 0.79 | 0.7856427548756789 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.18 | 1.9e-10 | ○○○○○ 1 | 1.000756795566255 | 29101196 |
Retrieved 2 of 2 entries in 118.9 ms
(Link to these results)