Bacterial taxon 1392858
Locus CO715_02580
Protein ATI04717.1
hypothetical protein
Escherichia coli M12
Length 179 aa, Gene n/a, UniProt n/a
>ATI04717.1|Escherichia coli M12|hypothetical protein
MKKVFLCAILASLSYPAIASSLQDQLSAVAEAEQQGKNEEQRQHDEWIAERNREIQQEKQRRANAQAAANKRAATAAANKKARQDKLDAEATADKKRDQSYEDELRSLEIQKQKLALAKEEARVKRENEFIDQELKHKAAQTDVVQSEADANRNMTEGGRDLMKSVGKAEENKSDSWFN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.18 | 0.00028 | ○○○○○ 0.3 | 0.29908024964733454 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.11 | 0.0012 | ○○○○○ 0.32 | 0.31514599274449684 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)