Bacterial taxon 1392858
Locus CO715_02995
Protein ATI04795.1
hypothetical protein
Escherichia coli M12
Length 122 aa, Gene n/a, UniProt n/a
>ATI04795.1|Escherichia coli M12|hypothetical protein
MKKIICLVITLLMTLPVYAKLTAHEEARINAMLEGLAQKKDLIFVRNGDEHTCDEAVSHLRLKLGNTRNRIDTAEQFIDKVASSSSITGKPYIVKMPGKSDENAQPFLHALIAQTDKTVPAQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.86 | 7.1e-6 | ●●○○○ -1.93 | -1.928841890502006 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.48 | 0.00066 | ●●○○○ -1.22 | -1.2236183623408547 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)