Bacterial taxon 1392858
Locus CO715_03040
Protein ATI04804.1
hypothetical protein
Escherichia coli M12
Length 72 aa, Gene n/a, UniProt n/a
>ATI04804.1|Escherichia coli M12|hypothetical protein
MEKEQLIEIANTIMPFGKYKGRRLIDLPEEYLLWFARKDEFPAGKLGELMQITLLIKTEGLTQLVQPLKRPL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.63 | 7.4e-5 | ●○○○○ -0.84 | -0.8365800059092172 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.55 | 0.013 | ○○○○○ 1.29 | 1.2861845430586973 | 29101196 |
Retrieved 2 of 2 entries in 2.2 ms
(Link to these results)