Bacterial taxon 1392858
Locus CO715_03300
Protein ATI04847.1
hypothetical protein
Escherichia coli M12
Length 63 aa, Gene n/a, UniProt n/a
>ATI04847.1|Escherichia coli M12|hypothetical protein
MQLTPTNQKLNVTHVDFETFAELIRSDPQKVSTSTWVYDVKSTNGGKAIGIASGDDYLVIVLI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.58 | 0.0041 | ●●○○○ -1.66 | -1.6613577002349658 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.16 | 0.0096 | ●●○○○ -1.57 | -1.573935020264693 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)