Bacterial taxon 1392858
Locus CO715_03330
Protein ATI04852.1
hypothetical protein
Escherichia coli M12
Length 56 aa, Gene n/a, UniProt n/a
>ATI04852.1|Escherichia coli M12|hypothetical protein
MPFSVSIESSSLQGGDYQAMIKSANQGVWTSVDVLLQSPTPKQADTVSFRHGWQTA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.51 | 1.2e-8 | ●●○○○ -1.44 | -1.4370632349174401 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.22 | 0.013 | ○○○○○ 1.01 | 1.008268052079214 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)