Bacterial taxon 1392858
Locus CO715_05185
Protein ATI05177.1
hypothetical protein
Escherichia coli M12
Length 74 aa, Gene n/a, UniProt n/a
>ATI05177.1|Escherichia coli M12|hypothetical protein
MSTPDFSTAENNQELANEVSCLKAMLTLMLQAMGQADAGRVMLKMEKQLALIEDETQAAVFSKTVKQIKQAYRQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.85 | 3.9e-7 | ●○○○○ -0.26 | -0.2571700243401296 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.96 | 3.4e-17 | ○○○○○ 1.79 | 1.7896473754411995 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)