Bacterial taxon 1392858
Locus CO715_05240
Protein ATI05185.1
hypothetical protein
Escherichia coli M12
Length 107 aa, Gene n/a, UniProt n/a
>ATI05185.1|Escherichia coli M12|hypothetical protein
MRLLILTLSLITLAGCTVTRQAHVSEVDAATGIVRLVYDQAFLQHAHTDRYVSRGIADRACQQEGYTHAIPFGQPVGNCSLFAGSLCLNTEFTLSYQCHHSAFPVFL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.17 | 2.0e-9 | ●○○○○ -0.32 | -0.32435404092826287 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.6 | 7.6e-8 | ●○○○○ -0.21 | -0.20584310483490975 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)