Bacterial taxon 1392858
Locus CO715_05250
Protein ATI05187.1
hypothetical protein
Escherichia coli M12
Length 48 aa, Gene n/a, UniProt n/a
>ATI05187.1|Escherichia coli M12|hypothetical protein
MLSEHIAWRYVFERLAIVIEHTFQDFAQFHRGTPTICYTGVIVFALII
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.58 | 2.4e-9 | ○○○○○ 0.87 | 0.8749432489741917 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.6 | 3.9e-10 | ○○○○○ 0.88 | 0.8803680453446621 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)