Bacterial taxon 1392858
Locus CO715_05415
Protein ATI05216.1
hypothetical protein
Escherichia coli M12
Length 131 aa, Gene n/a, UniProt n/a
>ATI05216.1|Escherichia coli M12|hypothetical protein
MVSALYAVLSALLLMKFSFDVVRLRMQYRVAYGDGGFSELQSAIRIHGNAVEYIPIAIVLMLFMEMNGAETWMVHICGIVLLAGRLMHYYGFHHRLFRWRRSGMSATWCALLLMVLANLWYMPWELVFSLR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -12.53 | 2.0e-13 | ●●●○○ -2.07 | -2.0688433660629917 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.5 | 2.1e-12 | ●●○○○ -1.85 | -1.8539379713866648 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)