Bacterial taxon 1392858
Locus CO715_05930
Protein ATI05298.1
hypothetical protein
Escherichia coli M12
Length 92 aa, Gene n/a, UniProt n/a
>ATI05298.1|Escherichia coli M12|hypothetical protein
MKDFTLKFRDREGYKAFLNEINWEDNEVLQDQLLIDEIGFAFDEVGRNADDEPIYQRRDGYFVNIRILDEKLDASPFTGNVVILDAPLREWA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.62 | 4.5e-17 | ●●○○○ -1.25 | -1.252202866292949 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.56 | 0.05 | ○○○○○ 0.87 | 0.8720222047747076 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)